PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A12G2549
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family Trihelix
Protein Properties Length: 464aa    MW: 53405.7 Da    PI: 5.996
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A12G2549genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix93.22.5e-2939123187
     trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                  rW++qe+laL+++r+em+ ++r++  k+plWeevs+k++e g++rs+k+Ckek+en+ k+++++keg+++++  + +++++f+qlea
  Gh_A12G2549  39 RWPRQETLALLKIRSEMDVAFRDSGVKAPLWEEVSRKLAELGYNRSAKKCKEKFENVYKYHRRTKEGRSGKS--NGKNYRFFEQLEA 123
                  8********************************************************************974..4457*******85 PP

2trihelix104.86.2e-33303388187
     trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                  rW+k+ev aLi++r++++ +++++  k+plWe++s +m++ g+ rs+k+Ckekwen+nk++k++ke++kkr +e+s+tcpyf+ql+a
  Gh_A12G2549 303 RWPKDEVEALIRLRTNLDMQYQDTGPKGPLWEDISTAMKKLGYDRSAKRCKEKWENMNKYFKRVKESNKKR-PEDSKTCPYFHQLDA 388
                  8*********************************************************************8.99***********85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500907.3993296IPR017877Myb-like domain
SMARTSM007172.7E-43698IPR001005SANT/Myb domain
CDDcd122039.01E-2438103No hitNo description
PfamPF138371.8E-1938124No hitNo description
PROSITE profilePS500907.677296360IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.605.9E-5299360IPR009057Homeodomain-like
SMARTSM007170.001300362IPR001005SANT/Myb domain
SuperFamilySSF466895.91E-5301373IPR009057Homeodomain-like
PfamPF138371.0E-23302389No hitNo description
CDDcd122031.07E-24302367No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 464 aa     Download sequence    Send to blast
MENSSFPESN TVGDNVSLEN EEEAKVKNEE SEGNFSGNRW PRQETLALLK IRSEMDVAFR  60
DSGVKAPLWE EVSRKLAELG YNRSAKKCKE KFENVYKYHR RTKEGRSGKS NGKNYRFFEQ  120
LEALDHHPSL VPPASGDINT SVEPLNVIHD AIPFSVGNPA SNFNETSTST TSSSGKESDG  180
TRKKKRKLTD FFERLMREMM EKQENLQKKF IEAIEKSEQD RMAREEAWKV QELARLKRER  240
ELLVQERSIA AAKDAAVLAF LQKFSDQTTS VQLPDISFAV EKVVDRQENS NGSESYMHLS  300
TSRWPKDEVE ALIRLRTNLD MQYQDTGPKG PLWEDISTAM KKLGYDRSAK RCKEKWENMN  360
KYFKRVKESN KKRPEDSKTC PYFHQLDALY KEKTKTIDGS GYELKPEELL MHMMGAQEER  420
LHQESATEDV ESENVNQNRE ENRNAEGDAY QIVANDPSPM PIIG
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1182187KKKRKL
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.245490.0embryo| ovule
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012437382.10.0PREDICTED: trihelix transcription factor GT-2-like
SwissprotQ391171e-127TGT2_ARATH; Trihelix transcription factor GT-2
TrEMBLA0A0D2SY590.0A0A0D2SY59_G
STRINGPOPTR_0001s31660.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM59952847
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76880.11e-121Trihelix family protein